[PR] Gain and Get More Likes and Followers on Instagram.

#kipranalewu

8198 posts

TOP POSTS

Penampakan sundel bolong di KPL
#jejakparanormal
#kipranalewu
#2014

Mantap sngat menghibur tayanganny sngat spektakuler ap lg ada sosok idola q @kipranalewu jadi lengkap deh serrunya.πŸ˜€πŸ˜†
#ilklawakclub #keren #kipranalewu

Iwan Bopeng Sampi ,,, #kpl #kipranalewu

Maafkan sy yg blm bs moveOn..
Sedih abis nonton JP yg ini😒😭😭😭😭
#flashback
#JP
#petakasiulan
#kipranalewu

Nyengir !!
Bersyukur atas nikmat yg engkau turunkan kepada kami,selamat Berbuka 😁😁
Thxgod

MOST RECENT

Waw ini makhluk apa?? Kok serba putih pucat😱
#kipranalewu

Alhamdulillah akhirny bisa ktmu jg am idola q aki @kipranalewu cici @bqueny dan rasa rindu yg dr dulu kini telah terobati stelah brtemu, semoga suatu saat nanti bisa berjumpa kembali. Aamiin... #kipranalewu #bqueny #kpls #lequeners #pdpl #357

My logo kpls 😍😍
#kipranalewufans
#kipranalewu
#kplspekalongan

Dalam Dunia Mistik Bertuah Mustika ini dikenal dengan nama Mustika Lipan 1000 / Mustika Lipan Seribu / Geliga Lipan Seribu / Batu Bertuah Lipan Seribu yang pada intinya Batu Mustika dimaksud adalah Mustika Lipan 1000 ini. Khasiat dan Manfaat Mustika Lipan Seribu ini sangat dipercaya keampuhannya dan kegunaannya Insya Allah sebagai Pusaka Batu Mustika Tembus Pandang yang maksudnya untuk membuka cakra kepekaan mata batin, membantu membuka mata batin atau memudahkan membangkitkan ilmu terawangan dan ilmu indera keenam, sehingga pemilik Mustika Lipan Seribu mempunyai kepekaan yang lebih dalam menerawang atau memperkirakan sesuatu. Selain itu Mustika Lipan Seribu juga dianggap ampuh untuk Kekebalan / Kebal dari ancaman santet, guna guna dan ilmu sihir. Keselamatan ; agar terhindar / diberi keselamatan dari kecelakaan, musibah, bencana, ancaman musuh, serangan fisik dan ghaib. Pagar Gaib ; tolak Bala dari gangguan jin kafir, makhluk halus, gangguan gaib, dan mengembalikan serangan gaib dari musuh serta memudahkan pemilik dalam meraih kekayaan dan kelancaran segala macam usaha.
Mustika Lipan 1000 ini mempunyai motif serat lipan yang sangat indah dan sayang jika tidak memiliknya, SEBELUM TERLAMBAT DAN SEBELUM KEHABISAN SEGERA MILIKI MUSTIKA LIPAN SERIBU INI. PERHATIKAN SEMUA GAMBAR FOTO MUSTIKA LIPAN INI SEBELUM MENGAMBILNYA.
Produk Jenis ini dikenal juga dengan nama Batu Fosil Jasper Serat Lipan Seribu.
Produk jenis ini ditemukan Ribuan Tahun Silam.
Tingkat Kekerasan 3-5 Mohs.
Ukuran Batu : -+ 20x15x10 milimeter.
Stok Mustika Lipan Seribu Jumlah Sangat Sangat Terbatas, SEGERA MILIKI SEBELUM HABIS, kami kirim sesuai persediaan yang masih ada.
Asal Usul Hasil Penarikan dengan Laku Tirakat Spiritual Tingkat Tinggi.
Mendapatkan Bonus Minyak Pusaka untuk Perawatan Khusus Mustika Lipan Seribu.

10001

Harga : 300.000

#batumustika#batumustikagaib#batumustikabertuah#batumustikakelapa#batumustikagaibbatumustikabertuah#batuakik#batuakikindo#batuakiknusantara#kipranalewu#batuakikmurahmeriah#batuakikindonesia#batuakikunik#batuakiklangka#batuakikonline#batuakikcantik#batuakiklovers#kipranalewu#kijokobodo#mbahmijan#pusakadunia#duniapusaka#mustikalipan1000 @RepostIt_app

Special thank u for all... thank u buat kk ipar yg rocker yg udh cuekin aq kmrn n tau" nongol tengah mlm bw tumpeng thank u buat dwi n rendy jg coklatnya bs" gendut...
Thank u tartnya buat kakak ipar yg plg genit
Special thank u for my brother n sister... tau aja wangi sk an cc
Special thank u for pakdhe n budhe buat smua giftnya...
Thank u buat kpls malaysia n lindsay buat cake nya... i think going to be fat😭...
Thank u ci lia n omcil always tau ap yg aq sk...
Thank for all people yg udh ucapin thanks buat doa" nya jg love u all... #3month #20month #bayiasi #babyarfa #rafisqyarfadhiakramadhanferdyanto #rafisqyarfadhiakplramadhan #arfa #rafisqy #babyray #richardaqilarajendraraflyferdyanto #richardaqilarajendrarafly #aqila #ray #mothercare #drbrowns #mybaby #fq #kq #love #mantanrahasia #kipranalewu #queny

Most Popular Instagram Hashtags