[PR] Gain and Get More Likes and Followers on Instagram.

#cwi

6217 posts

TOP POSTS

I am woman and i must be strong woman
#cwi #iedmubarak #happyiedmubarak

Gonna miss being an ironworker fa sho buuut prolly not really. Welding, that's my get down. Always has been. Give me a day of full pens and column splices WHOOOO EEEEE hot and fast BABY BOI try and keep up! What! ....but for real fuck that noise. I'm trying to kick back and get paid from here on out 🤣 and unlike all these retarded millennial inspectors I been seeing lately I put my years in behind the hood. 10+ #hangingupmybags #cwi #rejectseverywhere #certifyme #soicanuncertifyyou

when your inspection explains why the earth is flat. 😂#pipeline #welder #cwi #welding

Good for another three years! #CWI #CWE good to be on both sides of the game! I don't want to hear CWIs' do not know how to weld!

| DATA infographic
One of the audience members of last Thursdays Experiment at the science park Amsterdam is looking at the interactive Infographic that is showing the engagement of audience and of the speaker next to the speakers hart-rate and his acceleration in the space.
Photo by: @parapluke
Infographic by: @dspbrg
#byborre
#CWI
#cwiinbedrijf

Interview today with Curtis Morton of Nevis TV #CricketWestIndies #CWI

MOST RECENT

#MonsoonMonday Did you know we cater?! Our catering is fun, healthy, and the freshest Asian cuisine you can get delivered 🚗‼️ All you have to do is tell us the base and protein, how many guests to serve, and we take care of the rest. Impress your staff and coworkers with a new flare in catering options. Call us today at 208-606-9398 📱 #monsoonnampa #nampacatering #thaifood

Had my academy polygraph test this morning, passed 100% and was told by the examiner that I was a terrible​ lier 😂👮
#policeacademy #cwi #polygraph #sheriff #liedetector #nervousnesswasreal #itwasntasbadasyouthinkbutstillitwasprettysketchyatfirst

How to straighten the fins on your condenser unit!

I am woman and i must be strong woman
#cwi #iedmubarak #happyiedmubarak

Gonna miss being an ironworker fa sho buuut prolly not really. Welding, that's my get down. Always has been. Give me a day of full pens and column splices WHOOOO EEEEE hot and fast BABY BOI try and keep up! What! ....but for real fuck that noise. I'm trying to kick back and get paid from here on out 🤣 and unlike all these retarded millennial inspectors I been seeing lately I put my years in behind the hood. 10+ #hangingupmybags #cwi #rejectseverywhere #certifyme #soicanuncertifyyou

Stability Ball & Foam Rolling Class. Join us for a Sneak Peak of our newest class this Wednesday night at 8:00 pm #stabilityball #foamrolling #strengthenandstretch #newclass #studioclasses #fortlauderdale #CWI

Come get refreshed tonight as we look at part II of the life of Gideon.
🙏starts at 5:15 and 🙌 starts at 6 see you all in the ☕️🏡✌️😎

Ied Mubarak😚😚
#cwi #duokaji

Sunday morning Vinyasa Flow at 10 am #sundaymorningyoga #vinyasaflow #fortlauderdaleyoga #CWI

Thank you @hayleydupuis for coming in today! @hayleydupuis tried something new and loved it. She also enjoys our Boba teas. Today was the perfect day because of our BOGO special. Want to be featured? Use #MonsoonNampa or tag us at @monsoonnampa. We love when you share your photos of your delicious food. #MonsoonNampa #NampaFood #bogo

Most Popular Instagram Hashtags