#chipotleathome

628 posts

TOP POSTS

Pinterest made me do it πŸ€—πŸŒΆπŸ†πŸ›Me and the babe made dinner tonight #chipotleathome#missedcooking#healthyfood#tabascosauce

When chipotle is life and your wife is cute. #chipotleathome #sowedontgetsick

Super excited about this! I found a chipotle seasoned tofu last night at the store and my gears started turning! πŸ’™πŸ’™ I did a half salad/ half rice /protein bowl concoction! πŸ€— Spicy black beans, brown rice, spring mix, tomatoes, cucumbers, green peppers, red onion, chipotle tofu, and avacados! Even whipped up my own chipotle dressing with a bit of plain ranch, olive oil and fajita seasoning. πŸ™ƒπŸ€“ Pretty good throw together !
#foodie #avacado #chipotleathome #proteinbowl #chefcourt

New YT video 1/9/2017 Meal Prep #kimonica #mealprepsunday #mealprep #chipotle #chipotleathome https://youtu.be/RbmYVXn0nQk

Spent a chunk of the afternoon meal prepping. I'm excited to try these out. #chipotleathome #burritobowls @lubenbird

3 lbs boneless chuck roast (fat trimmed)
2 chipotles in adobo sauce, chopped (or more to taste)
1 (4-ounce) can chopped green chiles
1 small white onion, finely chopped (about 1 cup)
1/4 cup fresh lime juice
2 tablespoons apple cider vinegar
3 bay leaves
1 Tablespoon ground cumin
1 Tablespoon dried Mexican oregano (or regular oregano)
2 teaspoons salt
1 teaspoon black pepper
1/4 tsp ground cloves
1/2 cup beef stock or water
Put it all in the slow cooker and cook low 10-12 hours, remove the bay leaves and enjoy! #healthydinnerideas #slowcooker #barbacoa #whoneedschipotle #chipotleathome

Look who's joined Team Sofritas! Brandon and I get it with our burrito bowls every time, but now Avery has joined the tofu fun. Here she is with her "kids meal" of tomato salsa, Sofritas, black beans, tortillas, and orange slices. What do your kids get at @chipotlemexicangrill #sofritas #vegankids #chipotlekidsmeal #chipotleathome

6 mile run today followed by home made burrito bowls with carnitas πŸ˜‹ so delicious #ChipotleAtHome #Carnitas #HomeMade #FitFoods

Yes! Eindelijk gelukt om de smaak van 'Chipotle' op ons bord te krijgen! In de paasvakantie enkele keren bij Chipotle gegeten in Amerika.. en man wat miste ik die smaak! En hier op de camping smaakt het des te beter! #chipotleathome #mexicanfood #campingfood #pulledchicken

MOST RECENT

Super excited about this! I found a chipotle seasoned tofu last night at the store and my gears started turning! πŸ’™πŸ’™ I did a half salad/ half rice /protein bowl concoction! πŸ€— Spicy black beans, brown rice, spring mix, tomatoes, cucumbers, green peppers, red onion, chipotle tofu, and avacados! Even whipped up my own chipotle dressing with a bit of plain ranch, olive oil and fajita seasoning. πŸ™ƒπŸ€“ Pretty good throw together !
#foodie #avacado #chipotleathome #proteinbowl #chefcourt

Homemade burrito bowl! Cilantro lime rice, chili black beans, fresh avocado, fresh salsa, grilled chicken and cheddar cheese. #burritobowls # grilledchicken #blackbeans #avocado #cilantrolimerice #chipotleathome #rubioathome

Mom and I made imitation "chipotle bowls" using brown rice, chile lime chicken (made by yours truly), black beans, tamatillo salsa, onion & lettuce πŸ₯— #HappyDetoxing #CleanEating #Healthy #livinghealthylivinghappytaketwo #glutenFree #hashimotos #fuelingmybody #chipotleAtHome

DIY homemade Chipotle..i think i died and went to heaven πŸ˜‚ soo yummy and a healthy option over Taco Bell #diychipotle #chipotleathome #homemade

I did a lil homemade #chipotle #fajitabowl tonight for dinner the kids had sour cream and cheese but i didnt... i did make it woth white rice cuz i ran out of brown πŸ˜‚πŸ˜‚πŸ˜‚πŸ˜‚
#cookingwithkina #whatsfordinner #homechef #homemadechipotle #chipotleathome #southwestbowl #foodporn #foodstagram #instafood #prettyfood #itsallaboutpresentation

#Repost @ashlynchange4life2012 ・・・
3 lbs boneless chuck roast (fat trimmed)
2 chipotles in adobo sauce, chopped (or more to taste)
1 (4-ounce) can chopped green chiles
1 small white onion, finely chopped (about 1 cup)
1/4 cup fresh lime juice
2 tablespoons apple cider vinegar
3 bay leaves
1 Tablespoon ground cumin
1 Tablespoon dried Mexican oregano (or regular oregano)
2 teaspoons salt
1 teaspoon black pepper
1/4 tsp ground cloves
1/2 cup beef stock or water
Put it all in the slow cooker and cook low 10-12 hours, remove the bay leaves and enjoy! #healthydinnerideas #slowcooker #barbacoa #whoneedschipotle #chipotleathome . . . #slowcookercentral #slowcooking #crockpot #meals #recipes #recipe #dinner #cooking #yummy #slowcookerrecipes #slowcooker #homecooking #instafood #easy #foodporn #inspo

3 lbs boneless chuck roast (fat trimmed)
2 chipotles in adobo sauce, chopped (or more to taste)
1 (4-ounce) can chopped green chiles
1 small white onion, finely chopped (about 1 cup)
1/4 cup fresh lime juice
2 tablespoons apple cider vinegar
3 bay leaves
1 Tablespoon ground cumin
1 Tablespoon dried Mexican oregano (or regular oregano)
2 teaspoons salt
1 teaspoon black pepper
1/4 tsp ground cloves
1/2 cup beef stock or water
Put it all in the slow cooker and cook low 10-12 hours, remove the bay leaves and enjoy! #healthydinnerideas #slowcooker #barbacoa #whoneedschipotle #chipotleathome

His and Hers faux chipotle πŸ₯—πŸŒ― Used our #crockpot #carnitas over a salad for me and in a burrito bowl for Rewis! #chipotle #burritobowl #chipotleathome #fitmom #healthymom #workingmom #workingmama

When chipotle is life and your wife is cute. #chipotleathome #sowedontgetsick

Made my own little Fiesta Chipotle Bowl! Zatarains Cilantro Lime Rice which I added onion and a jalapeΓ±o, sautΓ©ed onion, bell pepper, banana pepper and grilled steak! Soooo yummy!πŸ˜‹ #chipotleathome #glutenfreedinner #fiesta

Most Popular Instagram Hashtags